![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (18 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.10: Filamin repeat (rod domain) [81290] (1 protein) |
![]() | Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species) |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (2 PDB entries) |
![]() | Domain d1qfha2: 1qfh A:750-857 [21894] |
PDB Entry: 1qfh (more details), 2.2 Å
SCOP Domain Sequences for d1qfha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum)} gangedssfgsftftvaaknkkgevktyggdkfevsitgpaeeitldaidnqdgtytaay slvgngrfstgvklngkhiegspfkqvlgnpgkknpevksftttrtan
Timeline for d1qfha2: