Lineage for d1qfha2 (1qfh A:750-857)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9664Protein F-actin cross-linking gelation factor (ABP-120), one repeat (ROD 4) [49239] (1 species)
  7. 9665Species Slime mold (Dictyostelium discoideum), different domains [49240] (2 PDB entries)
  8. 9667Domain d1qfha2: 1qfh A:750-857 [21894]

Details for d1qfha2

PDB Entry: 1qfh (more details), 2.2 Å

PDB Description: dimerization of gelation factor from dictyostelium discoideum: crystal structure of rod domains 5 and 6

SCOP Domain Sequences for d1qfha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfha2 b.1.1.5 (A:750-857) F-actin cross-linking gelation factor (ABP-120), one repeat (ROD 4) {Slime mold (Dictyostelium discoideum), different domains}
gangedssfgsftftvaaknkkgevktyggdkfevsitgpaeeitldaidnqdgtytaay
slvgngrfstgvklngkhiegspfkqvlgnpgkknpevksftttrtan

SCOP Domain Coordinates for d1qfha2:

Click to download the PDB-style file with coordinates for d1qfha2.
(The format of our PDB-style files is described here.)

Timeline for d1qfha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfha1