Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (23 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins) Pfam PF00630 |
Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species) |
Species Dictyostelium discoideum [TaxId:44689] [49240] (3 PDB entries) Uniprot P13466 547-857 |
Domain d1qfha1: 1qfh A:646-749 [21893] Rod domains 5 and 6 |
PDB Entry: 1qfh (more details), 2.2 Å
SCOP Domain Sequences for d1qfha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} kpapsaehsyaegeglvkvfdnapaeftifavdtkgvartdggdpfevaingpdglvvda kvtdnndgtygvvydapvegnynvnvtlrgnpiknmpidvkcie
Timeline for d1qfha1: