Lineage for d1qfha1 (1qfh A:646-749)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160729Protein F-actin cross-linking gelation factor (ABP-120), one repeat (ROD 4) [49239] (1 species)
  7. 160730Species Slime mold (Dictyostelium discoideum), different domains [49240] (2 PDB entries)
  8. 160731Domain d1qfha1: 1qfh A:646-749 [21893]

Details for d1qfha1

PDB Entry: 1qfh (more details), 2.2 Å

PDB Description: dimerization of gelation factor from dictyostelium discoideum: crystal structure of rod domains 5 and 6

SCOP Domain Sequences for d1qfha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfha1 b.1.1.5 (A:646-749) F-actin cross-linking gelation factor (ABP-120), one repeat (ROD 4) {Slime mold (Dictyostelium discoideum), different domains}
kpapsaehsyaegeglvkvfdnapaeftifavdtkgvartdggdpfevaingpdglvvda
kvtdnndgtygvvydapvegnynvnvtlrgnpiknmpidvkcie

SCOP Domain Coordinates for d1qfha1:

Click to download the PDB-style file with coordinates for d1qfha1.
(The format of our PDB-style files is described here.)

Timeline for d1qfha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfha2