Lineage for d1euu_1 (1euu 403-505)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456196Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (17 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 456368Protein Sialidase, "linker" domain [49237] (1 species)
    follows the catalytic six-bladed beta-propeller domain
  7. 456369Species Micromonospora viridifaciens [TaxId:1881] [49238] (2 PDB entries)
  8. 456371Domain d1euu_1: 1euu 403-505 [21892]
    Other proteins in same PDB: d1euu_2, d1euu_3

Details for d1euu_1

PDB Entry: 1euu (more details), 2.5 Å

PDB Description: sialidase or neuraminidase, large 68kd form

SCOP Domain Sequences for d1euu_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euu_1 b.1.18.2 (403-505) Sialidase, "linker" domain {Micromonospora viridifaciens}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

SCOP Domain Coordinates for d1euu_1:

Click to download the PDB-style file with coordinates for d1euu_1.
(The format of our PDB-style files is described here.)

Timeline for d1euu_1: