SCOPe 2.08: Domain d1euua1: 1euu A:403-505

Lineage for d1euua1 (1euu A:403-505)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Sialidase, linker domain [49237] (1 species)
   follows the catalytic six-bladed beta-propeller domain

7. Species Micromonospora viridifaciens [TaxId:1881] [49238] (4 PDB entries)
   Uniprot Q02834 47-647

8. Domain d1euua1: 1euu A:403-505 [21892]
   Other proteins in same PDB: d1euua2, d1euua3
   complexed with gal, na

Details for d1euua1

PDB Entry: 1euu, 2.5 Å

PDB Description: sialidase or neuraminidase, large 68kd form

PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1euua1:

Sequence; same for both SEQRES and ATOM records:

>d1euua1 b.1.18.2 (A:403-505) Sialidase, linker domain {Micromonospora viridifaciens [TaxId: 1881]}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

Timeline for d1euua1:

• d1euua1 first appeared (with stable ids) in SCOP 1.55, called d1euu_1
  
• d1euua1 appears in SCOPe 2.07