![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Sialidase, linker domain [49237] (1 species) follows the catalytic six-bladed beta-propeller domain |
![]() | Species Micromonospora viridifaciens [TaxId:1881] [49238] (4 PDB entries) Uniprot Q02834 47-647 |
![]() | Domain d1euua1: 1euu A:403-505 [21892] Other proteins in same PDB: d1euua2, d1euua3 complexed with gal, na |
PDB Entry: 1euu (more details), 2.5 Å
SCOPe Domain Sequences for d1euua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euua1 b.1.18.2 (A:403-505) Sialidase, linker domain {Micromonospora viridifaciens [TaxId: 1881]} gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld
Timeline for d1euua1: