Lineage for d4aj2b1 (4aj2 B:2-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847859Species Norway rat (Rattus norvegicus) [TaxId:10116] [226329] (13 PDB entries)
  8. 2847865Domain d4aj2b1: 4aj2 B:2-159 [218918]
    Other proteins in same PDB: d4aj2a2, d4aj2b2, d4aj2c2, d4aj2d2
    automated match to d9ldta1
    complexed with 52c, gol, mli

Details for d4aj2b1

PDB Entry: 4aj2 (more details), 1.75 Å

PDB Description: rat ldha in complex with 5-(2-chlorophenyl)-1h-tetrazole
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4aj2b1:

Sequence, based on SEQRES records: (download)

>d4aj2b1 c.2.1.0 (B:2-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgem
mdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiip
nvvkyspqckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d4aj2b1 c.2.1.0 (B:2-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alkdqlivnllkeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
dlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipn
vvkyspqckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d4aj2b1:

Click to download the PDB-style file with coordinates for d4aj2b1.
(The format of our PDB-style files is described here.)

Timeline for d4aj2b1: