SCOP 1.67: Domain d1eut_1: 1eut 403-505

Lineage for d1eut_1 (1eut 403-505)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Sialidase, "linker" domain [49237] (1 species)
   follows the catalytic six-bladed beta-propeller domain

7. Species Micromonospora viridifaciens [TaxId:1881] [49238] (2 PDB entries)

8. Domain d1eut_1: 1eut 403-505 [21891]
   Other proteins in same PDB: d1eut_2, d1eut_3
   complexed with na

Details for d1eut_1

PDB Entry: 1eut, 2.5 Å

PDB Description: sialidase, large 68kd form, complexed with galactose

SCOP Domain Sequences for d1eut_1:

Sequence; same for both SEQRES and ATOM records:

>d1eut_1 b.1.18.2 (403-505) Sialidase, "linker" domain {Micromonospora viridifaciens}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

Timeline for d1eut_1:

• d1eut_1 first appeared (with stable ids) in SCOP 1.55
  
• d1eut_1 appears in SCOP 1.65
  
• d1eut_1 appears in SCOP 1.69
  
• d1eut_1 appears in the current release, SCOPe 2.08, called d1euta1