SCOPe 2.07: Domain d4aj0c_: 4aj0 C:

Lineage for d4aj0c_ (4aj0 C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d4aj0c_: 4aj0 C: [218906]
   automated match to d1cd0b_
   complexed with act, pg0

Details for d4aj0c_

PDB Entry: 4aj0, 1.7 Å

PDB Description: Crystallographic structure of an amyloidogenic variant, 3rCW, of the germinal line lambda 3

PDB Compounds: (C:) germinal line lambda 3 3rcw variant

SCOPe Domain Sequences for d4aj0c_:

Sequence; same for both SEQRES and ATOM records:

>d4aj0c_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiperf
sgsnsgntatltisgtqamdeadyycqaadsstavvfgggtkltvl

Timeline for d4aj0c_:

• d4aj0c_ first appeared in SCOPe 2.03
  
• d4aj0c_ appears in SCOPe 2.06
  
• d4aj0c_ appears in the current release, SCOPe 2.08, called d4aj0c1