SCOPe 2.08: Domain d4aizd1: 4aiz D:3-96

Lineage for d4aizd1 (4aiz D:3-96)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4aizd1: 4aiz D:3-96 [218903]
   Other proteins in same PDB: d4aiza2, d4aizc2, d4aizd2
   automated match to d1cd0b_
   complexed with 88q, cit, so4

Details for d4aizd1

PDB Entry: 4aiz, 1.75 Å

PDB Description: Crystallographic structure of 3mJL2 from the germinal line lambda 3

PDB Compounds: (D:) v2-17 protein

SCOPe Domain Sequences for d4aizd1:

Sequence; same for both SEQRES and ATOM records:

>d4aizd1 b.1.1.0 (D:3-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elmqppsvsvspgqtaritcsgdalpkqyaywyqqkpgqapvlviykdserpsgiperfs
gsssgttvtltisgvqaedeadyycqsadssgty

Timeline for d4aizd1:

• d4aizd1 first appeared in SCOPe 2.03, called d4aizd_
  
• d4aizd1 was called d4aizd_ in SCOPe 2.07