SCOPe 2.08: Domain d4aixc1: 4aix C:2-95

Lineage for d4aixc1 (4aix C:2-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d4aixc1: 4aix C:2-95 [218898]
   Other proteins in same PDB: d4aixa2, d4aixb2, d4aixc2, d4aixd2
   automated match to d1cd0b_

Details for d4aixc1

PDB Entry: 4aix, 1.8 Å

PDB Description: Crystallographic structure of an amyloidogenic variant, 3rC34Y, of the germinal line lambda 3

PDB Compounds: (C:) ig lambda chain v-IV region bau

SCOPe Domain Sequences for d4aixc1:

Sequence; same for both SEQRES and ATOM records:

>d4aixc1 b.1.1.1 (C:2-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiperf
sgsnsgntatltisgtqamdeadyycqawdssta

Timeline for d4aixc1:

• d4aixc1 first appeared in SCOPe 2.03, called d4aixc_
  
• d4aixc1 was called d4aixc_ in SCOPe 2.07