Lineage for d4aixb_ (4aix B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355231Domain d4aixb_: 4aix B: [218897]
    automated match to d1cd0b_

Details for d4aixb_

PDB Entry: 4aix (more details), 1.8 Å

PDB Description: Crystallographic structure of an amyloidogenic variant, 3rC34Y, of the germinal line lambda 3
PDB Compounds: (B:) ig lambda chain v-IV region bau

SCOPe Domain Sequences for d4aixb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aixb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiperf
sgsnsgntatltisgtqamdeadyycqawdsstavvfgggtkltvl

SCOPe Domain Coordinates for d4aixb_:

Click to download the PDB-style file with coordinates for d4aixb_.
(The format of our PDB-style files is described here.)

Timeline for d4aixb_: