Lineage for d4aixa1 (4aix A:2-95)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742315Domain d4aixa1: 4aix A:2-95 [218896]
    Other proteins in same PDB: d4aixa2, d4aixb2, d4aixc2, d4aixd2
    automated match to d1cd0b_

Details for d4aixa1

PDB Entry: 4aix (more details), 1.8 Å

PDB Description: Crystallographic structure of an amyloidogenic variant, 3rC34Y, of the germinal line lambda 3
PDB Compounds: (A:) ig lambda chain v-IV region bau

SCOPe Domain Sequences for d4aixa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aixa1 b.1.1.1 (A:2-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiperf
sgsnsgntatltisgtqamdeadyycqawdssta

SCOPe Domain Coordinates for d4aixa1:

Click to download the PDB-style file with coordinates for d4aixa1.
(The format of our PDB-style files is described here.)

Timeline for d4aixa1: