![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
![]() | Protein automated matches [190701] (13 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [226464] (1 PDB entry) |
![]() | Domain d4aiva_: 4aiv A: [218895] automated match to d2jo6a1 complexed with gol |
PDB Entry: 4aiv (more details), 2 Å
SCOPe Domain Sequences for d4aiva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aiva_ b.33.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} diqvwttacaydhlipgrgvgvllddgsqvalfrlddgsvhavgnvdpfsgaavmsrgiv gdrggramvqspilkqafalddgsclddprvsvpvyparvtpegriqvarvav
Timeline for d4aiva_: