Lineage for d4aiva_ (4aiv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782562Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2782563Protein automated matches [190701] (13 species)
    not a true protein
  7. 2782678Species Mycobacterium tuberculosis [TaxId:83332] [226464] (1 PDB entry)
  8. 2782679Domain d4aiva_: 4aiv A: [218895]
    automated match to d2jo6a1
    complexed with gol

Details for d4aiva_

PDB Entry: 4aiv (more details), 2 Å

PDB Description: Crystal Structure of putative NADH-dependent nitrite reductase small subunit from Mycobacterium tuberculosis
PDB Compounds: (A:) probable nitrite reductase [nad(p)h] small subunit nird

SCOPe Domain Sequences for d4aiva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aiva_ b.33.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
diqvwttacaydhlipgrgvgvllddgsqvalfrlddgsvhavgnvdpfsgaavmsrgiv
gdrggramvqspilkqafalddgsclddprvsvpvyparvtpegriqvarvav

SCOPe Domain Coordinates for d4aiva_:

Click to download the PDB-style file with coordinates for d4aiva_.
(The format of our PDB-style files is described here.)

Timeline for d4aiva_: