Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Lactobacillus acidophilus [TaxId:272621] [226448] (1 PDB entry) |
Domain d4aiea2: 4aie A:466-538 [218894] Other proteins in same PDB: d4aiea1 automated match to d1uoka1 complexed with ca, gol, mes |
PDB Entry: 4aie (more details), 2.05 Å
SCOPe Domain Sequences for d4aiea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aiea2 b.71.1.0 (A:466-538) automated matches {Lactobacillus acidophilus [TaxId: 272621]} gdfslvsntqdavlayyrilndkkwlvvanlsneeqnfvsndqietilsnypernnvqni tlkpyeafiskvi
Timeline for d4aiea2: