Lineage for d4aiea1 (4aie A:2-465)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083970Species Lactobacillus acidophilus [TaxId:272621] [226447] (1 PDB entry)
  8. 2083971Domain d4aiea1: 4aie A:2-465 [218893]
    Other proteins in same PDB: d4aiea2
    automated match to d1uoka2
    complexed with ca, gol, mes

Details for d4aiea1

PDB Entry: 4aie (more details), 2.05 Å

PDB Description: Structure of glucan-1,6-alpha-glucosidase from Lactobacillus acidophilus NCFM
PDB Compounds: (A:) glucan 1,6-alpha-glucosidase

SCOPe Domain Sequences for d4aiea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aiea1 c.1.8.0 (A:2-465) automated matches {Lactobacillus acidophilus [TaxId: 272621]}
aswwknavvyqvypksfqdsngdgigdlqgiisrldyleklgidaiwlspvyqspgvdng
ydisdyeaidpqygtmadmdeliskakehhikivmdlvvnhtsdqhkwfveakkgkdnqy
rdyyiwrdpvdehepndlksafsgsawkydersgqyylhffadqqpdlnwqntelrqkiy
nmmnfwldkgiggfrmdvieligkdpdknirengpmlhpylqemnkatfgkrdvmtvget
wnatpkiaeeysdpdrhelsmvfqfenqsldqqpgkekwdlkpldlgelkkvlvkwqtki
dfdhawnslfwenhdiprvisrwgndqeyrvqcakmfaiilhmmhgtpyifngeeigmtn
cpvknidevediesinmynerlaegydeeelihainvkgrdnarrpmqwndeknagfsev
dpwlsvnpnykdinvenaladpnsifytyqkliklrhenpivvd

SCOPe Domain Coordinates for d4aiea1:

Click to download the PDB-style file with coordinates for d4aiea1.
(The format of our PDB-style files is described here.)

Timeline for d4aiea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aiea2