Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Lactobacillus acidophilus [TaxId:272621] [226447] (1 PDB entry) |
Domain d4aiea1: 4aie A:2-465 [218893] Other proteins in same PDB: d4aiea2 automated match to d1uoka2 complexed with ca, gol, mes |
PDB Entry: 4aie (more details), 2.05 Å
SCOPe Domain Sequences for d4aiea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aiea1 c.1.8.0 (A:2-465) automated matches {Lactobacillus acidophilus [TaxId: 272621]} aswwknavvyqvypksfqdsngdgigdlqgiisrldyleklgidaiwlspvyqspgvdng ydisdyeaidpqygtmadmdeliskakehhikivmdlvvnhtsdqhkwfveakkgkdnqy rdyyiwrdpvdehepndlksafsgsawkydersgqyylhffadqqpdlnwqntelrqkiy nmmnfwldkgiggfrmdvieligkdpdknirengpmlhpylqemnkatfgkrdvmtvget wnatpkiaeeysdpdrhelsmvfqfenqsldqqpgkekwdlkpldlgelkkvlvkwqtki dfdhawnslfwenhdiprvisrwgndqeyrvqcakmfaiilhmmhgtpyifngeeigmtn cpvknidevediesinmynerlaegydeeelihainvkgrdnarrpmqwndeknagfsev dpwlsvnpnykdinvenaladpnsifytyqkliklrhenpivvd
Timeline for d4aiea1: