Lineage for d4ai8a_ (4ai8 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807787Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1807938Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)
  6. 1807939Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)
  7. 1807940Species Human (Homo sapiens) [TaxId:9606] [82196] (28 PDB entries)
  8. 1807958Domain d4ai8a_: 4ai8 A: [218892]
    automated match to d2y0ia_
    complexed with dza, gol, so4, zn

Details for d4ai8a_

PDB Entry: 4ai8 (more details), 2.4 Å

PDB Description: factor inhibiting hif-1 alpha in complex with daminozide
PDB Compounds: (A:) Hypoxia-inducible factor 1-alpha inhibitor

SCOPe Domain Sequences for d4ai8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ai8a_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]}
sgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlv
ypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefve
klqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlllig
megnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdye
rfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieypl
kahqkvaimrniekmlgealgnpqevgpllntmikgryn

SCOPe Domain Coordinates for d4ai8a_:

Click to download the PDB-style file with coordinates for d4ai8a_.
(The format of our PDB-style files is described here.)

Timeline for d4ai8a_: