Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (2 proteins) |
Protein automated matches [190145] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186870] (15 PDB entries) |
Domain d4ai8a_: 4ai8 A: [218892] automated match to d2y0ia_ complexed with dza, gol, so4, zn |
PDB Entry: 4ai8 (more details), 2.4 Å
SCOPe Domain Sequences for d4ai8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ai8a_ b.82.2.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlv ypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefve klqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlllig megnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdye rfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieypl kahqkvaimrniekmlgealgnpqevgpllntmikgryn
Timeline for d4ai8a_: