Lineage for d4ahua_ (4ahu A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493948Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2494110Protein automated matches [190209] (5 species)
    not a true protein
  7. 2494245Species Human immunodeficiency virus [TaxId:12721] [193331] (20 PDB entries)
  8. 2494266Domain d4ahua_: 4ahu A: [218888]
    automated match to d2itga_
    complexed with acy, cl, edo, gol, ico, so4

Details for d4ahua_

PDB Entry: 4ahu (more details), 1.9 Å

PDB Description: parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4ahua_:

Sequence, based on SEQRES records: (download)

>d4ahua_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkggiggysagerivdiiatdiqt

Sequence, based on observed residues (ATOM records): (download)

>d4ahua_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkgggysagerivdiiatdiqt

SCOPe Domain Coordinates for d4ahua_:

Click to download the PDB-style file with coordinates for d4ahua_.
(The format of our PDB-style files is described here.)

Timeline for d4ahua_: