Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein automated matches [190209] (4 species) not a true protein |
Species Human immunodeficiency virus [TaxId:12721] [193331] (20 PDB entries) |
Domain d4ahta_: 4aht A: [218886] automated match to d2itga_ complexed with acy, edo, q6t, so4, tam |
PDB Entry: 4aht (more details), 1.8 Å
SCOPe Domain Sequences for d4ahta_:
Sequence, based on SEQRES records: (download)
>d4ahta_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]} sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta vqmavfihnhkrkggiggysagerivdiiatdiq
>d4ahta_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]} sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta vqmavfihnhkrkggysagerivdiiatdiq
Timeline for d4ahta_: