SCOPe 2.07: Domain d4ahra_: 4ahr A:

Lineage for d4ahra_ (4ahr A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (5 species)
   not a true protein

7. Species Human immunodeficiency virus [TaxId:12721] [193331] (20 PDB entries)

8. Domain d4ahra_: 4ahr A: [218882]
   automated match to d2itga_
   complexed with acy, gol, i2e, so4

Details for d4ahra_

PDB Entry: 4ahr, 1.9 Å

PDB Description: parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4ahra_:

Sequence, based on SEQRES records:

>d4ahra_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkggiggysagerivdiiatdiqt

Sequence, based on observed residues (ATOM records):

>d4ahra_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkgggysagerivdiiatdiqt

Timeline for d4ahra_:

• d4ahra_ first appeared in SCOPe 2.03
  
• d4ahra_ appears in SCOPe 2.06
  
• d4ahra_ appears in the current release, SCOPe 2.08