SCOPe 2.06: Domain d4ahqd_: 4ahq D:

Lineage for d4ahqd_ (4ahq D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (75 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries)

8. Domain d4ahqd_: 4ahq D: [218881]
   Other proteins in same PDB: d4ahqa2, d4ahqb2
   automated match to d2ehhc_
   mutant

Details for d4ahqd_

PDB Entry: 4ahq, 1.95 Å

PDB Description: Crystal Structure of N-acetylneuraminic acid lyase mutant K165C from Staphylococcus aureus

PDB Compounds: (D:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4ahqd_:

Sequence; same for both SEQRES and ATOM records:

>d4ahqd_ c.1.10.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]}
kdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkkq
vfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeirdy
yfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvcytapnffllerirkafp
dklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndi
ietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

Timeline for d4ahqd_:

• d4ahqd_ first appeared in SCOPe 2.03
  
• d4ahqd_ appears in SCOPe 2.05
  
• d4ahqd_ appears in SCOPe 2.07
  
• d4ahqd_ appears in the current release, SCOPe 2.08