Lineage for d4ahqc_ (4ahq C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1573064Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1573065Protein automated matches [190115] (57 species)
    not a true protein
  7. 1573424Species Staphylococcus aureus [TaxId:93061] [193178] (5 PDB entries)
  8. 1573427Domain d4ahqc_: 4ahq C: [218880]
    automated match to d2ehhc_
    mutant

Details for d4ahqc_

PDB Entry: 4ahq (more details), 1.95 Å

PDB Description: Crystal Structure of N-acetylneuraminic acid lyase mutant K165C from Staphylococcus aureus
PDB Compounds: (C:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4ahqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ahqc_ c.1.10.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvcytapnffllerirkaf
pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d4ahqc_:

Click to download the PDB-style file with coordinates for d4ahqc_.
(The format of our PDB-style files is described here.)

Timeline for d4ahqc_: