| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries) |
| Domain d4ahqa1: 4ahq A:2-293 [218878] Other proteins in same PDB: d4ahqa2, d4ahqb2 automated match to d2ehhc_ mutant |
PDB Entry: 4ahq (more details), 1.95 Å
SCOPe Domain Sequences for d4ahqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ahqa1 c.1.10.0 (A:2-293) automated matches {Staphylococcus aureus [TaxId: 93061]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvcytapnffllerirkaf
pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
Timeline for d4ahqa1:
View in 3DDomains from other chains: (mouse over for more information) d4ahqb1, d4ahqb2, d4ahqc_, d4ahqd_ |