Lineage for d4ahqa1 (4ahq A:2-293)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836622Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries)
  8. 2836623Domain d4ahqa1: 4ahq A:2-293 [218878]
    Other proteins in same PDB: d4ahqa2, d4ahqb2
    automated match to d2ehhc_
    mutant

Details for d4ahqa1

PDB Entry: 4ahq (more details), 1.95 Å

PDB Description: Crystal Structure of N-acetylneuraminic acid lyase mutant K165C from Staphylococcus aureus
PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4ahqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ahqa1 c.1.10.0 (A:2-293) automated matches {Staphylococcus aureus [TaxId: 93061]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvcytapnffllerirkaf
pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d4ahqa1:

Click to download the PDB-style file with coordinates for d4ahqa1.
(The format of our PDB-style files is described here.)

Timeline for d4ahqa1: