![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (51 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93061] [193178] (5 PDB entries) |
![]() | Domain d4ahpc_: 4ahp C: [218876] automated match to d2ehhc_ complexed with cl |
PDB Entry: 4ahp (more details), 2.1 Å
SCOPe Domain Sequences for d4ahpc_:
Sequence, based on SEQRES records: (download)
>d4ahpc_ c.1.10.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]} hhhhhhnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfll nteqkkqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypft feeirdyyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnfflle rirkafpdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayql qhdsndiietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
>d4ahpc_ c.1.10.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]} hhhhhhnkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfll nteqkkqvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypft feeirdyyfdiieatqnnmiiyaisieqfselfnhekivgvkytapnffllerirkafpd klilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndii etvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl
Timeline for d4ahpc_: