Lineage for d4ahpa1 (4ahp A:2-293)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086896Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries)
  8. 2086905Domain d4ahpa1: 4ahp A:2-293 [218874]
    Other proteins in same PDB: d4ahpa2, d4ahpb2, d4ahpc2
    automated match to d2ehhc_
    complexed with cl

Details for d4ahpa1

PDB Entry: 4ahp (more details), 2.1 Å

PDB Description: Crystal Structure of Wild Type N-acetylneuraminic acid lyase from Staphylococcus aureus
PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4ahpa1:

Sequence, based on SEQRES records: (download)

>d4ahpa1 c.1.10.0 (A:2-293) automated matches {Staphylococcus aureus [TaxId: 93061]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

Sequence, based on observed residues (ATOM records): (download)

>d4ahpa1 c.1.10.0 (A:2-293) automated matches {Staphylococcus aureus [TaxId: 93061]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyisieqfselfnhekivgvkytapnffllerirkafpdklilsgf
demlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndiietvlsmg
iyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d4ahpa1:

Click to download the PDB-style file with coordinates for d4ahpa1.
(The format of our PDB-style files is described here.)

Timeline for d4ahpa1: