SCOPe 2.03: Domain d4ahcb1: 4ahc B:1-347

Lineage for d4ahcb1 (4ahc B:1-347)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (20 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [224898] (3 PDB entries)

8. Domain d4ahcb1: 4ahc B:1-347 [218868]
   Other proteins in same PDB: d4ahca2, d4ahcb2
   automated match to d2vwja1
   complexed with gol

Details for d4ahcb1

PDB Entry: 4ahc, 2.4 Å

PDB Description: Crystal Structure of an Evolved Replicating DNA Polymerase

PDB Compounds: (B:) DNA polymerase

SCOPe Domain Sequences for d4ahcb1:

Sequence; same for both SEQRES and ATOM records:

>d4ahcb1 c.55.3.0 (B:1-347) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
kivrivdvekvekkflgkpitvwklylehpqdqptirekvrehpavvdifeydipfakry
lidkglipmegeeelkilafaiatlyhegeefgkgpiimisyadeneakvitwknidlpy
vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe
sgenlervakysmedakatyelgkeflpmeiqlsrligqplwdvsrs

Timeline for d4ahcb1:

• d4ahcb1 is new in SCOPe 2.03-stable
  
• d4ahcb1 appears in SCOPe 2.04
  
• d4ahcb1 appears in the current release, SCOPe 2.08