Lineage for d4ahca2 (4ahc A:348-757)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2572851Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 2572852Protein automated matches [226844] (11 species)
    not a true protein
  7. 2572891Species Pyrococcus furiosus [TaxId:2261] [224944] (3 PDB entries)
  8. 2572892Domain d4ahca2: 4ahc A:348-757 [218867]
    Other proteins in same PDB: d4ahca1, d4ahcb1
    automated match to d2vwja2
    complexed with gol

Details for d4ahca2

PDB Entry: 4ahc (more details), 2.4 Å

PDB Description: Crystal Structure of an Evolved Replicating DNA Polymerase
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4ahca2:

Sequence, based on SEQRES records: (download)

>d4ahca2 e.8.1.0 (A:348-757) automated matches {Pyrococcus furiosus [TaxId: 2261]}
stgnlvewfllrkayernevapnkpseeeyqrrlresytggfvkepekglwddivyldfi
alypsiiithnvspdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktk
mketqdpiekilldyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwk
eleekfgfkvlyidtdglhatipggeseeikkkalefvkyinsklpglleleyegfykrg
ffvtkkryavideegkvitrgleivrrdwseiaketqarvletilkhgdveeavrivkev
iqklanyeippeklaiyeqitrplheykaigphvavakklaakgvkikpgmvigyivlrg
dgpisnrailaeeydpkkhkydaeyyienqvlpavlrilegfgyrkedlr

Sequence, based on observed residues (ATOM records): (download)

>d4ahca2 e.8.1.0 (A:348-757) automated matches {Pyrococcus furiosus [TaxId: 2261]}
stgnlvewfllrkayernevapnkpseeeyqrrlresytggfvkepekglwddivyldfi
alypsiiithnvspdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktk
mketqdpiekilldyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwk
eleekfgfkvlyidtdglhatipggeseeikkkalefvkyinsklpglleleyegfykrg
ffvtkkryavideegkvitrgleiiaketqarvletilkhgdveeavrivkeviqklany
eippeklaiyeigphvavakklakkhkydaeyyienqvlpavlrilegfgyrkedlr

SCOPe Domain Coordinates for d4ahca2:

Click to download the PDB-style file with coordinates for d4ahca2.
(The format of our PDB-style files is described here.)

Timeline for d4ahca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ahca1