Lineage for d1ggub1 (1ggu B:8-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765693Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 2765694Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 2765695Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (9 PDB entries)
    Coagulation factor XIII
  8. 2765701Domain d1ggub1: 1ggu B:8-190 [21886]
    Other proteins in same PDB: d1ggua2, d1ggua3, d1ggua4, d1ggub2, d1ggub3, d1ggub4
    complexed with ca

Details for d1ggub1

PDB Entry: 1ggu (more details), 2.1 Å

PDB Description: human factor xiii with calcium bound in the ion site
PDB Compounds: (B:) protein (coagulation factor xiii)

SCOPe Domain Sequences for d1ggub1:

Sequence, based on SEQRES records: (download)

>d1ggub1 b.1.18.9 (B:8-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
ced

Sequence, based on observed residues (ATOM records): (download)

>d1ggub1 b.1.18.9 (B:8-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
fggrravppnnsnaaeddlptvelqgvvqeflnvtsvhlfkerwdtnkvdhhtdkyennk
livrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgak
ivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced

SCOPe Domain Coordinates for d1ggub1:

Click to download the PDB-style file with coordinates for d1ggub1.
(The format of our PDB-style files is described here.)

Timeline for d1ggub1: