SCOPe 2.03: Domain d4ah2a1: 4ah2 A:4-83

Lineage for d4ah2a1 (4ah2 A:4-83)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (8 PDB entries)

8. Domain d4ah2a1: 4ah2 A:4-83 [218858]
   Other proteins in same PDB: d4ah2a2
   automated match to d1muja2
   complexed with gol

Details for d4ah2a1

PDB Entry: 4ah2, 2.36 Å

PDB Description: hla-dr1 with covalently linked clip106-120 in canonical orientation

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4ah2a1:

Sequence; same for both SEQRES and ATOM records:

>d4ah2a1 d.19.1.0 (A:4-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytpit

Timeline for d4ah2a1:

• d4ah2a1 is new in SCOPe 2.03-stable
  
• d4ah2a1 appears in SCOPe 2.04
  
• d4ah2a1 appears in the current release, SCOPe 2.08