Lineage for d1ggua1 (1ggu A:8-190)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770734Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 1770735Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 1770736Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (8 PDB entries)
    Coagulation factor XIII
  8. 1770743Domain d1ggua1: 1ggu A:8-190 [21885]
    Other proteins in same PDB: d1ggua2, d1ggua3, d1ggua4, d1ggub2, d1ggub3, d1ggub4
    complexed with ca

Details for d1ggua1

PDB Entry: 1ggu (more details), 2.1 Å

PDB Description: human factor xiii with calcium bound in the ion site
PDB Compounds: (A:) protein (coagulation factor xiii)

SCOPe Domain Sequences for d1ggua1:

Sequence, based on SEQRES records: (download)

>d1ggua1 b.1.18.9 (A:8-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
ced

Sequence, based on observed residues (ATOM records): (download)

>d1ggua1 b.1.18.9 (A:8-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
fggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyennklivrrg
qsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmred
rsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced

SCOPe Domain Coordinates for d1ggua1:

Click to download the PDB-style file with coordinates for d1ggua1.
(The format of our PDB-style files is described here.)

Timeline for d1ggua1: