Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (7 PDB entries) Coagulation factor XIII |
Domain d1ggua1: 1ggu A:8-190 [21885] Other proteins in same PDB: d1ggua2, d1ggua3, d1ggua4, d1ggub2, d1ggub3, d1ggub4 |
PDB Entry: 1ggu (more details), 2.1 Å
SCOP Domain Sequences for d1ggua1:
Sequence, based on SEQRES records: (download)
>d1ggua1 b.1.18.9 (A:8-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme} fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw ced
>d1ggua1 b.1.18.9 (A:8-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme} fggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyennklivrrg qsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmred rsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced
Timeline for d1ggua1:
View in 3D Domains from other chains: (mouse over for more information) d1ggub1, d1ggub2, d1ggub3, d1ggub4 |