Lineage for d4agna_ (4agn A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2767926Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2768088Protein automated matches [190198] (2 species)
    not a true protein
  7. 2768089Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. 2768141Domain d4agna_: 4agn A: [218845]
    automated match to d2ahia_
    complexed with nxg, zn; mutant

Details for d4agna_

PDB Entry: 4agn (more details), 1.6 Å

PDB Description: structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5116
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4agna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4agna_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenlrkk

SCOPe Domain Coordinates for d4agna_:

Click to download the PDB-style file with coordinates for d4agna_.
(The format of our PDB-style files is described here.)

Timeline for d4agna_: