Lineage for d4agmb_ (4agm B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1772172Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1772173Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1772265Protein automated matches [190198] (2 species)
    not a true protein
  7. 1772266Species Human (Homo sapiens) [TaxId:9606] [186941] (47 PDB entries)
  8. 1772274Domain d4agmb_: 4agm B: [218844]
    automated match to d2ahia_
    complexed with p86, zn; mutant

Details for d4agmb_

PDB Entry: 4agm (more details), 1.52 Å

PDB Description: structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5086
PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4agmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4agmb_ b.2.5.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
vcacpgrdrrteeenlrk

SCOPe Domain Coordinates for d4agmb_:

Click to download the PDB-style file with coordinates for d4agmb_.
(The format of our PDB-style files is described here.)

Timeline for d4agmb_: