Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
Protein automated matches [190198] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186941] (47 PDB entries) |
Domain d4agmb_: 4agm B: [218844] automated match to d2ahia_ complexed with p86, zn; mutant |
PDB Entry: 4agm (more details), 1.52 Å
SCOPe Domain Sequences for d4agmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4agmb_ b.2.5.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr vcacpgrdrrteeenlrk
Timeline for d4agmb_: