SCOPe 2.07: Domain d4agma_: 4agm A:

Lineage for d4agma_ (4agm A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)

8. Domain d4agma_: 4agm A: [218843]
   automated match to d2ahia_
   complexed with p86, zn; mutant

Details for d4agma_

PDB Entry: 4agm, 1.52 Å

PDB Description: structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5086

PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4agma_:

Sequence; same for both SEQRES and ATOM records:

>d4agma_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenlrkk

Timeline for d4agma_:

• d4agma_ first appeared in SCOPe 2.03
  
• d4agma_ appears in SCOPe 2.06
  
• d4agma_ appears in the current release, SCOPe 2.08