Lineage for d4afhe_ (4afh E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (5 species)
    not a true protein
  7. 2408897Species Capitella teleta [TaxId:283909] [193507] (3 PDB entries)
  8. 2408902Domain d4afhe_: 4afh E: [218837]
    automated match to d4b5dc_
    complexed with l0b

Details for d4afhe_

PDB Entry: 4afh (more details), 1.88 Å

PDB Description: Capitella teleta AChBP in complex with lobeline
PDB Compounds: (E:) achbp

SCOPe Domain Sequences for d4afhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4afhe_ b.96.1.0 (E:) automated matches {Capitella teleta [TaxId: 283909]}
nglmakrlrrellntyeqlgksglpflddigkvdvkfglslqllksieqrgmgfnsigtf
kaivklswvdtilrwdpeppfdfqkieispdeiwtpdiklfnsvdldmtldrttqaivfs
ngtvlwippavlkvlcvsqddvdschfqfgswvysvdevdihfmddkaevlldfyqdsle
ilensaqrqevvypccesayvemkyllalrse

SCOPe Domain Coordinates for d4afhe_:

Click to download the PDB-style file with coordinates for d4afhe_.
(The format of our PDB-style files is described here.)

Timeline for d4afhe_: