SCOPe 2.05: Domain d4afhc_: 4afh C:

Lineage for d4afhc_ (4afh C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species Capitella teleta [TaxId:283909] [193507] (3 PDB entries)

8. Domain d4afhc_: 4afh C: [218835]
   automated match to d4b5dc_
   complexed with l0b

Details for d4afhc_

PDB Entry: 4afh, 1.88 Å

PDB Description: capitella teleta achbp in complex with lobeline

PDB Compounds: (C:) achbp

SCOPe Domain Sequences for d4afhc_:

Sequence; same for both SEQRES and ATOM records:

>d4afhc_ b.96.1.0 (C:) automated matches {Capitella teleta [TaxId: 283909]}
snglmakrlrrellntyeqlgksglpflddigkvdvkfglslqllksieqrgmgfnsigt
fkaivklswvdtilrwdpeppfdfqkieispdeiwtpdiklfnsvdldmtldrttqaivf
sngtvlwippavlkvlcvsqddvdschfqfgswvysvdevdihfmddkaevlldfyqdsl
eilensaqrqevvypccesayvemkyllalrse

Timeline for d4afhc_:

• d4afhc_ first appeared in SCOPe 2.03
  
• d4afhc_ appears in SCOPe 2.04
  
• d4afhc_ appears in SCOPe 2.06
  
• d4afhc_ appears in the current release, SCOPe 2.08