Lineage for d1evua1 (1evu A:1-190)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9764Protein Transglutaminase factor XIII, N-terminal domain [49235] (1 species)
  7. 9765Species Human (Homo sapiens), blood [TaxId:9606] [49236] (7 PDB entries)
  8. 9768Domain d1evua1: 1evu A:1-190 [21883]
    Other proteins in same PDB: d1evua2, d1evua3, d1evua4, d1evub2, d1evub3, d1evub4

Details for d1evua1

PDB Entry: 1evu (more details), 2.01 Å

PDB Description: human factor xiii with calcium bound in the ion site
PDB Compounds: (A:)

SCOP Domain Sequences for d1evua1:

Sequence, based on SEQRES records: (download)

>d1evua1 b.1.1.5 (A:1-190) Transglutaminase factor XIII, N-terminal domain {Human (Homo sapiens), blood}
setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
yilfnpwced

Sequence, based on observed residues (ATOM records): (download)

>d1evua1 b.1.1.5 (A:1-190) Transglutaminase factor XIII, N-terminal domain {Human (Homo sapiens), blood}
setsrtafggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyenn
klivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwga
kivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced

SCOP Domain Coordinates for d1evua1:

Click to download the PDB-style file with coordinates for d1evua1.
(The format of our PDB-style files is described here.)

Timeline for d1evua1: