| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
| Family c.25.1.1: Reductases [52344] (5 proteins) |
| Protein automated matches [226995] (7 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [226086] (3 PDB entries) |
| Domain d4af7b2: 4af7 B:149-308 [218827] Other proteins in same PDB: d4af7a1, d4af7b1 automated match to d1frna2 complexed with fad; mutant |
PDB Entry: 4af7 (more details), 2.85 Å
SCOPe Domain Sequences for d4af7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4af7b2 c.25.1.1 (B:149-308) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllyke
efekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymmgl
kgmekgiddimvslaakdgidwieykrtlkkaeqwnvevy
Timeline for d4af7b2: