Lineage for d4af7a2 (4af7 A:149-308)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859732Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2859820Protein automated matches [226995] (7 species)
    not a true protein
  7. 2859840Species Pea (Pisum sativum) [TaxId:3888] [226086] (3 PDB entries)
  8. 2859841Domain d4af7a2: 4af7 A:149-308 [218825]
    Other proteins in same PDB: d4af7a1, d4af7b1
    automated match to d1frna2
    complexed with fad; mutant

Details for d4af7a2

PDB Entry: 4af7 (more details), 2.85 Å

PDB Description: pea fnr c266m mutant
PDB Compounds: (A:) Ferredoxin--NADP reductase, leaf isozyme, chloroplastic

SCOPe Domain Sequences for d4af7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4af7a2 c.25.1.1 (A:149-308) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllyke
efekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymmgl
kgmekgiddimvslaakdgidwieykrtlkkaeqwnvevy

SCOPe Domain Coordinates for d4af7a2:

Click to download the PDB-style file with coordinates for d4af7a2.
(The format of our PDB-style files is described here.)

Timeline for d4af7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4af7a1