SCOPe 2.07: Domain d4aenb1: 4aen B:3-92

Lineage for d4aenb1 (4aen B:3-92)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries)

8. Domain d4aenb1: 4aen B:3-92 [218815]
   Other proteins in same PDB: d4aena1, d4aena2, d4aenb2
   automated match to d1fv1b2
   complexed with gol

Details for d4aenb1

PDB Entry: 4aen, 2.2 Å

PDB Description: HLA-DR1 with covalently linked CLIP106-120 in reversed orientation

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d4aenb1:

Sequence; same for both SEQRES and ATOM records:

>d4aenb1 d.19.1.1 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

Timeline for d4aenb1:

• d4aenb1 first appeared in SCOPe 2.03
  
• d4aenb1 appears in SCOPe 2.06
  
• d4aenb1 appears in the current release, SCOPe 2.08