Lineage for d4aena2 (4aen A:84-180)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355681Domain d4aena2: 4aen A:84-180 [218814]
    Other proteins in same PDB: d4aena1, d4aenb1, d4aenb2
    automated match to d1muja1
    complexed with gol

Details for d4aena2

PDB Entry: 4aen (more details), 2.2 Å

PDB Description: HLA-DR1 with covalently linked CLIP106-120 in reversed orientation
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4aena2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aena2 b.1.1.0 (A:84-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpredh
lfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOPe Domain Coordinates for d4aena2:

Click to download the PDB-style file with coordinates for d4aena2.
(The format of our PDB-style files is described here.)

Timeline for d4aena2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aena1