SCOPe 2.08: Domain d4aena2: 4aen A:84-180

Lineage for d4aena2 (4aen A:84-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4aena2: 4aen A:84-180 [218814]
   Other proteins in same PDB: d4aena1, d4aenb1, d4aenb2
   automated match to d1muja1
   complexed with gol

Details for d4aena2

PDB Entry: 4aen, 2.2 Å

PDB Description: HLA-DR1 with covalently linked CLIP106-120 in reversed orientation

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4aena2:

Sequence; same for both SEQRES and ATOM records:

>d4aena2 b.1.1.0 (A:84-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpredh
lfrkfhylpflpstedvydcrvehwgldepllkhwef

Timeline for d4aena2:

• d4aena2 first appeared in SCOPe 2.03
  
• d4aena2 appears in SCOPe 2.07