Lineage for d4aena1 (4aen A:3-83)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545737Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)
  8. 2545752Domain d4aena1: 4aen A:3-83 [218813]
    Other proteins in same PDB: d4aena2, d4aenb1, d4aenb2
    automated match to d1muja2
    complexed with gol

Details for d4aena1

PDB Entry: 4aen (more details), 2.2 Å

PDB Description: HLA-DR1 with covalently linked CLIP106-120 in reversed orientation
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4aena1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aena1 d.19.1.0 (A:3-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytpit

SCOPe Domain Coordinates for d4aena1:

Click to download the PDB-style file with coordinates for d4aena1.
(The format of our PDB-style files is described here.)

Timeline for d4aena1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aena2