![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226044] (26 PDB entries) |
![]() | Domain d4aena1: 4aen A:3-83 [218813] Other proteins in same PDB: d4aena2, d4aenb1, d4aenb2 automated match to d1muja2 complexed with gol |
PDB Entry: 4aen (more details), 2.2 Å
SCOPe Domain Sequences for d4aena1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aena1 d.19.1.0 (A:3-83) automated matches {Human (Homo sapiens) [TaxId: 9606]} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytpit
Timeline for d4aena1: