Lineage for d4acsc1 (4acs C:4-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879614Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2879830Domain d4acsc1: 4acs C:4-80 [218803]
    Other proteins in same PDB: d4acsa2, d4acsb2, d4acsc2, d4acsd2
    automated match to d1k3ya2
    complexed with gsh; mutant

Details for d4acsc1

PDB Entry: 4acs (more details), 2.1 Å

PDB Description: crystal structure of mutant gst a2-2 with enhanced catalytic efficiency with azathioprine
PDB Compounds: (C:) glutathione s-transferase a2

SCOPe Domain Sequences for d4acsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acsc1 c.47.1.0 (C:4-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
klvqtrailnyiaskyn

SCOPe Domain Coordinates for d4acsc1:

Click to download the PDB-style file with coordinates for d4acsc1.
(The format of our PDB-style files is described here.)

Timeline for d4acsc1: