Lineage for d4acsb2 (4acs B:81-220)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713569Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 2713673Domain d4acsb2: 4acs B:81-220 [218802]
    Other proteins in same PDB: d4acsa1, d4acsb1, d4acsc1, d4acsd1
    automated match to d1agsa1
    complexed with gsh; mutant

Details for d4acsb2

PDB Entry: 4acs (more details), 2.1 Å

PDB Description: crystal structure of mutant gst a2-2 with enhanced catalytic efficiency with azathioprine
PDB Compounds: (B:) glutathione s-transferase a2

SCOPe Domain Sequences for d4acsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acsb2 a.45.1.1 (B:81-220) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikekalidmyiegiadlgemigdlsfsqpeeqdaklaliqektknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleesrkif

SCOPe Domain Coordinates for d4acsb2:

Click to download the PDB-style file with coordinates for d4acsb2.
(The format of our PDB-style files is described here.)

Timeline for d4acsb2: