SCOPe 2.06: Domain d4acpa1: 4acp A:238-341

Lineage for d4acpa1 (4acp A:238-341)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4acpa1: 4acp A:238-341 [218795]
   automated match to d1igyb3
   complexed with nag

Details for d4acpa1

PDB Entry: 4acp, 2.49 Å

PDB Description: deactivation of human igg1 fc by endoglycosidase treatment

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4acpa1:

Sequence, based on SEQRES records:

>d4acpa1 b.1.1.0 (A:238-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Sequence, based on observed residues (ATOM records):

>d4acpa1 b.1.1.0 (A:238-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshpevkfnwyvdgvevhnaktkpreeqtyrv
vsvltvlhqdwlngkeykckvsnkpiektiskakg

Timeline for d4acpa1:

• d4acpa1 first appeared in SCOPe 2.03
  
• d4acpa1 appears in SCOPe 2.05
  
• d4acpa1 appears in SCOPe 2.07
  
• d4acpa1 appears in the current release, SCOPe 2.08