Lineage for d4acfe1 (4acf E:4-104)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934813Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2934938Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2934939Protein automated matches [226862] (5 species)
    not a true protein
  7. 2935027Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries)
  8. 2935038Domain d4acfe1: 4acf E:4-104 [218790]
    Other proteins in same PDB: d4acfa2, d4acfb2, d4acfc2, d4acfd2, d4acfe2, d4acff2
    automated match to d1f52a1
    complexed with 46b, cl, mg, p3s, po4

Details for d4acfe1

PDB Entry: 4acf (more details), 2 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3- (butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l- methionine-s-sulfoximine phosphate.
PDB Compounds: (E:) glutamine synthetase 1

SCOPe Domain Sequences for d4acfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acfe1 d.15.9.0 (E:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOPe Domain Coordinates for d4acfe1:

Click to download the PDB-style file with coordinates for d4acfe1.
(The format of our PDB-style files is described here.)

Timeline for d4acfe1: