Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (8 PDB entries) Coagulation factor XIII |
Domain d1fiea1: 1fie A:9-190 [21879] Other proteins in same PDB: d1fiea2, d1fiea3, d1fiea4, d1fieb2, d1fieb3, d1fieb4 |
PDB Entry: 1fie (more details), 2.5 Å
SCOP Domain Sequences for d1fiea1:
Sequence, based on SEQRES records: (download)
>d1fiea1 b.1.18.9 (A:9-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme} ggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdk yennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsg kwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwc ed
>d1fiea1 b.1.18.9 (A:9-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme} ggrravppnnsnaaeddlptvflnvtsvhlfkerwdtnkvdhhtdkyennklivrrgqsf yvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmredrsv rlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced
Timeline for d1fiea1:
View in 3D Domains from other chains: (mouse over for more information) d1fieb1, d1fieb2, d1fieb3, d1fieb4 |