SCOPe 2.08: Domain d4acfc2: 4acf C:105-478

Lineage for d4acfc2 (4acf C:105-478)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries)

8. Domain d4acfc2: 4acf C:105-478 [218787]
   Other proteins in same PDB: d4acfa1, d4acfb1, d4acfc1, d4acfd1, d4acfe1, d4acff1
   automated match to d1f52a2
   complexed with 46b, cl, mg, p3s, po4

Details for d4acfc2

PDB Entry: 4acf, 2 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3- (butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l- methionine-s-sulfoximine phosphate.

PDB Compounds: (C:) glutamine synthetase 1

SCOPe Domain Sequences for d4acfc2:

Sequence; same for both SEQRES and ATOM records:

>d4acfc2 d.128.1.0 (C:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

Timeline for d4acfc2:

• d4acfc2 first appeared in SCOPe 2.03
  
• d4acfc2 appears in SCOPe 2.07